SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR198W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR198W
Domain Number 1 Region: 163-263
Classification Level Classification E-value
Superfamily TPR-like 0.000000885
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YGR198W
Sequence length 303
Comment YPP1 ORF Verified Cargo-transport protein involved in endocytosis; interacts with phosphatidylinositol-4-kinase Stt4; GFP-fusion protein localizes to the cytoplasm; YGR198W is an essential gene
Sequence
MEKTFQSIEVSKTAMFLFQNLSDNSNDEIKKKTFKRESILNFVNFVKYNDKYYQLHDNSH
RDIISFIDAYSFILQNSSKTDSIENVFDYDNTVSTFATSLNSFYKEYNLPLMSQSESLDW
LENSTRCVYPGNISKVLTNAWSTLYEIRKYQLDFLVSNNLTSYLCNAMMLSTKEKDNADV
EEQEEGEEEKALRELQFKYSYTLAQQRHIETAIKTLESLILSKNPNYYKAWHLLALCRSV
QEDKEMSYKIVCSVLEAMNESLQNNTLLLNDRWQFIHLKLTQLALIEEIFWHFRGTGDXS
RGL
Download sequence
Identical sequences YGR198W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]