SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHR117W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR117W
Domain Number 1 Region: 344-509
Classification Level Classification E-value
Superfamily TPR-like 1.45e-28
Family Tetratricopeptide repeat (TPR) 0.0053
Further Details:      
 
Domain Number 2 Region: 125-219
Classification Level Classification E-value
Superfamily TPR-like 6.51e-26
Family Tetratricopeptide repeat (TPR) 0.00082
Further Details:      
 
Domain Number 3 Region: 477-589
Classification Level Classification E-value
Superfamily TPR-like 0.0000000291
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YHR117W
Sequence length 639
Comment TOM71 ORF Verified Mitochondrial outer membrane protein with similarity to Tom70p; probable minor component of the TOM (translocase of outer membrane) complex responsible for recognition and import of mitochondrially directed proteins
Sequence
MAENSLLRFITKNKVAILATVSAGTAAVGAYVYYQQIKQQQQQQLKGTKDNRRQSEAFAG
QNEDEADLKDDGSVVSGSNKRKKKKNKRKRNNKAKSGEGFDYPSLPNGEPDIAQLKGLSP
SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV
IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD
ALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALAFCYTGIFHFLKNN
LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQ
MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP
EVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ
LDEEKFNAAIKLLTKARELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK
LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML
Download sequence
Identical sequences C8Z9R0 E7KPG6
YHR117W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]