SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKL022C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL022C
Domain Number 1 Region: 366-396,467-753
Classification Level Classification E-value
Superfamily TPR-like 9.1e-32
Family Tetratricopeptide repeat (TPR) 0.0067
Further Details:      
 
Domain Number 2 Region: 241-312,365-399
Classification Level Classification E-value
Superfamily TPR-like 0.0000000199
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YKL022C
Sequence length 840
Comment CDC16 ORF Verified Subunit of the anaphase-promoting complex/cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition; required for sporulation
Sequence
MKFCLYCCHCYIVICGKATHYYKSSKATSNLKSSNRVLMRNPMSPSEQHSQHNSTLAASP
FVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLANSPLIQKLQANIMTPHQPS
ANSNSNSNSITGNVVNDNNLLASMSKNSMFGSTIPXTLRKVSLQREYKDSVDGVXRDEDN
DEDVHNNGDAAANANNDRESKLGHNGPLTTTTLTTTTTATQLDVSELSAIERLRLWRFDA
LMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGXNILCRY
XLGLSFVKLQRFDDAXDXIGEYNPFSEDPXTTAANTMSNNGNNSNTSQPVTDGGIKMESS
LCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLXTPQEEWDLFDSLDFK
EFGEDKEIMKNLYKINXSKYINTEDITKSNEILAKDYKLADNVDVVRSKVDICYTQCKFN
ECLEXCETVLENXEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAIXWFSVATY
YMSLDRISEAQKYYSKSSILXPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHL
PKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKAL
EVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLK
TKKLQKAIDHLHKSLYLKPNNASATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDK
ASLNKKRSSLAYDPVNMAKRLRTQKEIFDQNNKALRKGGHDSKTGSNNADDDFDADMELE
Download sequence
Identical sequences YKL022C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]