SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR018C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR018C
Domain Number 1 Region: 50-148
Classification Level Classification E-value
Superfamily TPR-like 0.00000456
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 
Weak hits

Sequence:  YKR018C
Domain Number - Region: 163-229
Classification Level Classification E-value
Superfamily Histone-fold 0.0502
Family Bacterial histone-fold protein 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YKR018C
Sequence length 250
Comment ORF Uncharacterized Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus
Sequence
MFYYDGPFQFTDDDFDIPAAVKDSSNSEDSEDEEMDGPTLLHPGKILEDXLLQSRALFPN
SALWLLNEARMLSGKGRLEEAVALMDSIDVSKIRMRQVKSLMIFDRAITLIHLHQYDRAA
EDILSLLDISDWSHAFYTYFAGCCYLENWRMCEMGLMKSDKKDEYQKKAEELIFTSVNLL
GKKTFKSKNLPLDRFILRKVEQFKAKKEELGVENPLDGIATSPVHEISYFYNGYNRMSEE
HLELTKKXAN
Download sequence
Identical sequences YKR018C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]