SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLL022C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLL022C
Domain Number - Region: 196-324
Classification Level Classification E-value
Superfamily TPR-like 0.000155
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YLL022C
Sequence length 385
Comment HIF1 ORF Verified Non-essential component of the HAT-B histone acetyltransferase complex (Hat1p-Hat2p-Hif1p), localized to the nucleus; has a role in telomeric silencing
Sequence
MKLRAEDVLANGTSRHKLQIDMERQIQIAKDLLAQKKFLEAAKRCQQTLDSLPKDGLLPD
PELFTIFAQAVYNMEVQNSGNLFGDALLAGDDGSGSESESEPESDVSNGEEGNENGQTEI
PNSRMFQFDQEEEDLTGDVDSGDSEDSGEGSEEEEENVEKEEERLALHELANFSPANEYD
DEIEDVSQLRKSGFHIYFENDLYENALDLLAQALMLLGRPTADGQSLTENSRLRIGDVYI
LMGDIEREAEMFSRAIHHYLKALGYYKTLKPAEQVTEKVIQAEFLVCDALRWVDQVPAKD
KLKRFKHAKALLEKHMTTRPKDSELQQARLAQIQDDIDEVQENQQHGSKRPLSQPTTSIG
FPALEKPLGDFNDLSQLVKKKPRRH
Download sequence
Identical sequences B3LTE8 C8ZCV0 E7KRD9 E7LX73 E7Q6P7 H0GJW1
YLL022C YLL022C SCRT_04968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]