SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLL060C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL060C
Domain Number 1 Region: 85-213
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.5e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0059
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.75e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLL060C
Sequence length 219
Comment GTT2 ORF Verified Glutathione S-transferase capable of homodimerization; functional overlap with Gtt2p, Grx1p, and Grx2p
Sequence
MKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPV
LELDDGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHH
ATPGLGPEVEFYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIF
AAIVKLQVPEECEALRAWYKRMQQRPSVKKLLEIRSKSS
Download sequence
Identical sequences B3LTB9 C8ZCR6 E7KRB8 E7LX62 E7QHL7 H0GJT0
YLL060C YLL060C YLL060C YLL060C YLL060C YLL060C YLL060C SCRT_04935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]