SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR043C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR043C
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-35
Family SCOPe 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR043C
Sequence length 103
Comment TRX1 ORF Verified Cytoplasmic thioredoxin isoenzyme of the thioredoxin system which protects cells against oxidative and reductive stress, forms LMA1 complex with Pbi2p, acts as a cofactor for Tsa1p, required for ER-Golgi transport and vacuole inheritance
Sequence
MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDEL
GDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
Download sequence
Identical sequences A0A0L8VKJ6 A0A250WM28 A7A0U8 B3LT14 C7GU47 C8ZD15 E7KFE3 E7KRI6 E7LXD5 E7Q6H2 E7QHS0 G2WIN5 H0GK15 N1P7P9 P22217
YLR043C YLR043C YLR043C YLR043C YLR043C YLR043C SCRT_05030 YLR043C 2i9h_A YLR043C YLR043C YLR043C YLR043C ORFP:14676 YLR043C tr|A7A0U8|A7A0U8_YEAS7 000164987|e2i9hA1|2485.1.1.40|A:1-103 cath|current|2i9hA00/1-103 YLR043C YLR043C YLR043C YLR043C YLR043C YLR043C YLR043C YLR043C YLR043C NP_013144.1.97178 YLR043C YLR043C 4932.YLR043C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]