SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR097C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR097C
Domain Number 1 Region: 87-152
Classification Level Classification E-value
Superfamily F-box domain 0.00000436
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  YLR097C
Domain Number - Region: 12-49
Classification Level Classification E-value
Superfamily TPR-like 0.0759
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLR097C
Sequence length 360
Comment HRT3 ORF Verified Putative SCF-ubiquitin ligase F-box protein, based on both genetic and physical interactions and sequence similarity; identified in association with Cdc53p, Skp1p and Ubi4 in large and small-scale studies
Sequence
MIVDYEKDPRAKEAIAIWEKGVLKEKDGSMSDAINFYRSALKIHDNVESLYRKKILDEWM
LHKKLSGLSMTTDAPDEQNETGKDDLSAEENAELQPCWILEILPDDILLRIIKKVILMSG
ESWVNLSMTCSTFSKLCFHDSVPFKTFAKYIYSKQIYDKMAMDLNGITDINTFEKEIWRG
DDYRMLRERPYIKFEGVYISVVNYVRYGSNAESSLSLLKPVHMITYYRYFRFYENGQCLR
LLSTDEPSAVVKHFSKENKPRHSHMCYWSLGFDYDFGHLKITRSDEKYTFIEEFQIKNQG
NKRYQRLKWLSSIVVDKEGNASNCSLRNEKSFFLLQSEIFQGSWMTSMFFAVVLLYLLFL
Download sequence
Identical sequences E7KRM9
YLR097C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]