SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML028W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML028W
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.81e-64
Family Glutathione peroxidase-like 0.000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YML028W
Sequence length 196
Comment TSA1 ORF Verified Thioredoxin peroxidase, acts as both a ribosome-associated and free cytoplasmic antioxidant; self-associates to form a high-molecular weight chaperone complex under oxidative stress; deletion results in mutator phenotype
Sequence
MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAK
KFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEG
VALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATI
KPTVEDSKEYFEAANK
Download sequence
Identical sequences A0A0L8VKX5 A0A250WES8 A6ZM34 B3LLM4 C8ZEH6 E7KGA2 E7KSD6 E7LY84 E7QJ07 G2WK24 N1NY02 P34760
YML028W YML028W NP_013684.1.97178 SCRT_01867 YML028W YML028W YML028W YML028W YML028W YML028W YML028W 4932.YML028W YML028W YML028W YML028w___KOG0852 YML028W tr|A6ZM34|A6ZM34_YEAS7 YML028W YML028W YML028W YML028W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]