SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YML046W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML046W
Domain Number 1 Region: 23-278
Classification Level Classification E-value
Superfamily TPR-like 0.000000171
Family HAT/Suf repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YML046W
Sequence length 382
Comment PRP39 ORF Verified U1 snRNP protein involved in splicing, contains multiple tetriatricopeptide repeats
Sequence
MKKNLKTTRNIDIILRKTQTTVNEIWQFESKIKQPFFNLGQVLNDDLENWSRYLKFVTDP
SKSLDKEFVMSVFDRCLIPCLYHENTWMMYIKWLTKKNISDEVVVDIYQKANTFLPLDFK
TLRYDFLRFLKRKYRSNNTLFNNIFNETVSXYLKIWPNDILLMTEYLCMLKRHSFKNSLD
QSPKEILEKQTSFTKILETSISNYINNQIDAKVHLQTLINDKNLSIVVVELIKTTWLVLK
NNMQTRKYFNLYQKNILIKNSVPFWLTYYKFEKSNVNFTKLNKFIRELGVEIYLPTTVMN
DILTDYKTFYLTHSNIVTYESSIIDSNTFDPILYPELKMSNPKYDPVLNTTANVDWHKKD
GMEGGWSHRHNDGKTADIQQYN
Download sequence
Identical sequences YML046W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]