SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR012W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR012W
Domain Number 1 Region: 211-303
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 0.000000000196
Family Hypothetical protein c14orf129, hspc210 0.025
Further Details:      
 
Domain Number 2 Region: 993-1125
Classification Level Classification E-value
Superfamily TPR-like 0.000000235
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Weak hits

Sequence:  YMR012W
Domain Number - Region: 12-56
Classification Level Classification E-value
Superfamily Lipocalins 0.0542
Family Fatty acid binding protein-like 0.02
Further Details:      
 
Domain Number - Region: 679-791
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0915
Family HBL-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YMR012W
Sequence length 1270
Comment CLU1 ORF Verified eIF3 component of unknown function; deletion causes defects in mitochondrial organization but not in growth or translation initiation, can rescue cytokinesis and mitochondrial organization defects of the Dictyostelium cluA- mutant
Sequence
MSEKKEEVKNATVKVTVKLPKEDNHSHNTKHLKKTQSSKNNDISFEIGKESKIQTVLDVL
AMIPSSKYLTNVGLKTIEGDSQLSDEVSIKEIVGEKSELKLQLILKPYSAREALKHVITV
RDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIKERSKQEEKDEKSDPEEKKNTFKDVTD
EEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCVRSLSFAPYNPVPPFYRSKGHLFY
LQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKENTDENAHSSPIYYSLFDLIASRSK
KFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSSLPPNNPDYLRLQTAALDTTPERN
FNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTAASGAMSIFYSDFVAMNPESPTRD
QIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDLKTINILNRLHMHEVRYXLTTVVE
FAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDFVNDINVKYGLDEGLGKIVYDADF
DSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFDKRRYILDLANTYPLDINFARQNF
DNIEETENRYPHRQTLLRPELVEKWWNNKVEKEGVEFEKAYEENLFSYNPDAYQVEGIED
ANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLADTLHKNGINMRYLGKIIELSQKE
LDSQIVHYEQNLKAVEQGNKEYEDWEKSYLQKIENMIKERQAKINKLVQEGKEVPKELTE
DLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIVSRSLKHVLKDLGKDVPVFLVPSL
VAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLTRSELLEAVSKQAFLRFRHQLPSN
WIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTKEQLESYKQSLDKKIRNKFVEPPTTFSL
SDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSALTLLAQSITVLEDVNNILHPAVA
EKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDSFEMMRALXNLAILEFSNESPYN
ATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQDTKLAIEVLGQLSSYVVELE
GKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIFTKQLGMNHTHSAQSRQWVNGLS
SLIMDLKQKKQLAQDQMSTTGSNSAGHKKTNHRQKKDDVKPELANKSVDELLTFIEGDSS
NSKSKKQNQQ
Download sequence
Identical sequences YMR012W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]