SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR061W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR061W
Domain Number 1 Region: 33-494
Classification Level Classification E-value
Superfamily TPR-like 8.95e-66
Family HAT/Suf repeat 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YMR061W
Sequence length 497
Comment RNA14 ORF Verified Cleavage and polyadenylation factor I (CF I) component involved in cleavage and polyadenylation of mRNA 3' ends; bridges interaction between Rna15p and Hrp1p in the CF I complex
Sequence
MSSSTTPDLLYPSADKVAEPSDNIHGDELRLRERIKDNPTNILSYFQLIQYLETQESYAK
VREVYEQFHNTFPFYSPAWTLQLKGELARDEFETVEKILAQCLSGKLENNDLSLWSTYLD
YIRRKNNLITGGQEARAVIVKAFQLVMQKCAIFEPKSSSFWNEYLNFLEQWKPFNKWEEQ
QRIDMLREFYKKMLCVPFDNLEKMWNRYTQWEQEINSLTARKFIGELSAEYMKARSLYQE
WLNVTNGLKRASPINLRTANKKNIPQPGTSDSNIQQLQIWLNWIKWERENKLMLSEDMLS
QRISYVYKQGIQYMIFSAEMWYDYSMYISENSDRQNILYTALLANPDSPSLTFKLSECYE
LDNDSESVSNCFDKCTQTLLSQYKKIASDVNSGEDNNTEYEQELLYKQREKLTFVFCVYM
NTMKRISGLSAARTVFGKCRKLKRILTHDVYVENAYLEFQNQNDYKTAFKXLELGLKYFQ
NDGVYINKYLDFLIFFK
Download sequence
Identical sequences YMR061W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]