SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR115W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR115W
Domain Number - Region: 4-73,315-348
Classification Level Classification E-value
Superfamily TPR-like 0.00107
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YMR115W
Sequence length 383
Comment MGR3 ORF Verified Subunit of the mitochondrial (mt) i-AAA protease supercomplex, which degrades misfolded mitochondrial proteins; forms a subcomplex with Mgr1p that binds to substrates to facilitate proteolysis; required for growth of cells lacking mtDNA
Sequence
MDFNYKEALRQYIEALDECDRSHVDLLSDDYTRIELKIAEMYXKLNMLEEAQNLYQELLS
RFFEALNVPGKVDESERGEVLRKDLRILIKSLEINKDIESGKRKLLQHLLLAQEEILSKS
PELKEFFENRKKKLSMVKDINRDPNDDFKTFVSEENIKFDEQGYMILDLEKNSSAWEPFK
EEFFTARDLYTAYCLSSKDIAAALSCKITSVEWMVMADMPPGQILLSQANLGSLFYLQAE
KLEADLNQLEQKKSKESNQEXDMGTYIKAVRFVRKNRDLCLERAQKCYDSVIAFAKRNRK
IRFHVKDQLDPSIAQSIALSTYGMGVLSLHEGVLAKAEKLFKDSIXMAKETEFNELLAEA
EKELEKTTVLKAXQKRGFKLIPQ
Download sequence
Identical sequences E7KSN6
YMR115W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]