SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR218C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR218C
Domain Number - Region: 434-463
Classification Level Classification E-value
Superfamily TPR-like 0.0835
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YMR218C
Sequence length 800
Comment TRS130 ORF Verified One of 10 subunits of the transport protein particle (TRAPP) complex of the cis-Golgi which mediates vesicle docking and fusion; involved in ER to Golgi membrane traffic; mutation activates transcription of OCH1
Sequence
MDKEIYCGSVPVSYFDPFDLFESLRPEFQQILPLDNIHWKAFDGTVRTVNRLPIELIPEG
RGEADKSNDEQPFIRFLIVNCISIDQYRAKVRPLVRQWLPNLESVSSSTGEKMIYKPIIL
LYANSEVVDSNLFKSVSLMEKFGKDFPHVQTLEVRSVYRSPKDRQEFWNQFSQQIKASVL
SIFQKRLTHLQHSLANLQKGNNFEEQLLTREKLYELYVVFNILEDASLELQKIKKEILRR
NMNMPDGKLQVPFESSSKSDESLGSIIIEGTLDKFQLHKYFFIRRLRLLKLEDQTLTAFV
GAFQLIKNFIESISIEYRKSVRLLEFKHYFITSMLSYFEFENVSNPLLCEIKAELLMLKR
DNWVQGVMATSGYRLMDKNYPNSDVKYKFDLLKETFVDETVFQENFLTLTKEILSLFNKC
EGKRQRIVDILSIEIGLLYYQGKKYEEAVSLFLSCYEYYTQTNWNSIGLKILQVFIDSLS
HCPKLDVLQIDGESVSASAVLTNAFLNILKLCKDNDSKEIWWKKFMDLQMKNNIHLMYPL
DGLFEVTLNSKVHLARANVSAIEVNLKSYGFPEDISTKTMRLSLKNMGGDVIVFEASDFL
LKKGENKLILECRDIMYGEFSLLSFEIIVEGITFVKEFPENQDEFIVVPEIYCKESTKVL
VKQAHNLNLGEYALELKSVQSDALESLQVEVEVQKNIGNMKNLPVSFSMDEIQARKRYNT
PFENVRLEYYLLDQITAFDLIIKTSFTKKNDQGTFGETKKVRIQCYLQLSVSVEDIFKKG
YIFLQISSKLFSQGRASNFI
Download sequence
Identical sequences YMR218C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]