SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL121C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL121C
Domain Number 1 Region: 69-181
Classification Level Classification E-value
Superfamily TPR-like 1.84e-18
Family Tetratricopeptide repeat (TPR) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YNL121C
Sequence length 187
Comment TOM70 ORF Verified Component of the TOM (translocase of outer membrane) complex responsible for recognition and initial import steps for all mitochondrially directed proteins; acts as a receptor for incoming precursor proteins
Sequence
MASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFEEQL
DKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVXSYIYMALIMADR
NDXTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENYXPLYS
ISMSSVP
Download sequence
Identical sequences YNL121C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]