SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOL076W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOL076W
Domain Number - Region: 76-157
Classification Level Classification E-value
Superfamily TPR-like 0.0281
Family Tetratricopeptide repeat (TPR) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YOL076W
Sequence length 250
Comment MDM20 ORF Verified Non-catalytic subunit of the NatB N-terminal acetyltransferase, which catalyzes N-acetylation of proteins with specific N-terminal sequences; involved in mitochondrial inheritance and actin assembly
Sequence
MSDKIQEEILGLVSRSNFKQCYAKLGQLQKQFPNALYFKILETYVKFKQSPGKFDYNKLL
EEPYGLKGTTITGDTRSLEFLHNFFVELGKYDEALHVYERGNFKFPSYELSYHWFMKALE
DSNYNQMSKASLQLAKYSDSGNLPKRAYYFWNAISILAXSRFQENTLSDPKKILLSRLAR
QSLLDLKPFQNVQEIIVYCLVLDELFPQSREISEEIVAITFANFDTSVNLYLKNFILKHT
KLLNSPQKTF
Download sequence
Identical sequences YOL076W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]