SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR027W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR027W
Domain Number 1 Region: 261-384
Classification Level Classification E-value
Superfamily TPR-like 7.59e-42
Family Tetratricopeptide repeat (TPR) 0.000082
Further Details:      
 
Domain Number 2 Region: 5-118
Classification Level Classification E-value
Superfamily TPR-like 2.61e-38
Family Tetratricopeptide repeat (TPR) 0.00058
Further Details:      
 
Domain Number 3 Region: 394-496
Classification Level Classification E-value
Superfamily TPR-like 2.09e-31
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Weak hits

Sequence:  YOR027W
Domain Number - Region: 540-577
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0051
Family XPC-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOR027W
Sequence length 589
Comment STI1 ORF Verified Hsp90 cochaperone, interacts with the Ssa group of the cytosolic Hsp70 chaperones and activates Ssa1p ATPase activity; interacts with Hsp90 chaperones and inhibits their ATPase activity; homolog of mammalian Hop
Sequence
MSLTADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDAL
NDANECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKEGLDQVHRT
QQARQAQPDLGLTQLFADPNLIENLKKNAKTSEMMKDPQLVAKLIGYKQNPQAIGQDLFT
DPRLMTIMATLMGVDLNMDDINQSNSMPKEPETSKSTEQKKDAEPQSDSTTSKENSSKAP
QREESKESEPMEVDEDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNN
RAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFAXIGNAYHKLGDLKKTIEYYQ
KSLTEHRTADILTKLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYT
EMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEY
ASALETLDAARTKDTEVNNGSSAREIDQLYYKASQQRFQPGTSNETPEETYQRAMKDPEV
AAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTGR
Download sequence
Identical sequences E7KU82 H0GND9
YOR027W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]