SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR080W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR080W
Domain Number 1 Region: 19-149
Classification Level Classification E-value
Superfamily TPR-like 1.16e-17
Family Tetratricopeptide repeat (TPR) 0.0097
Further Details:      
 
Domain Number 2 Region: 203-272
Classification Level Classification E-value
Superfamily F-box domain 0.000000000366
Family F-box domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOR080W
Sequence length 350
Comment DIA2 ORF Verified Origin-binding F-box protein that forms an SCF ubiquitin ligase complex with Skp1p and Cdc53p; plays a role in DNA replication, involved in invasive and pseudohyphal growth
Sequence
MSSPGNSGVAIDSTVLKAIELGTRLFKSGEYLQAKRIFTNALRVCDSYSQEQIMRIRNXY
QLDTARPDNKRLYHPRYIKILDNICACYEKLNDLKSCLDVSQRLLKLEPGNIKCYIRCTR
TLIKLKDWKRAYKTCSRGLQLCNNDSNHLRQQKQFIKNNMVQKQDGKRSYIDPSEETKIA
KKXKNNNFLESLPKKKIKGSTKKTDLVGNLPIEILPIIFQRFTTNELVTLSLVCNKWRDK
ILYHLDCFQEFNLAPINFKNFVKFMDFLQQNFTRTYRKYILSQVKVSSRITSEELRITQL
LFSKMPKCINIERLILSMPTLTTTQIFKLMVRGGTDFFXKAAGIISHDNL
Download sequence
Identical sequences YOR080W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]