SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR249C from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOR249C
Domain Number - Region: 214-280
Classification Level Classification E-value
Superfamily TPR-like 0.00311
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOR249C
Sequence length 587
Comment APC5 ORF Verified Subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition
Sequence
MGYLEAINGLDSINRLMMDLEKNCLVNNYRSMKMRTTSTRRQMTRASFLGTFLSTCIRKY
QIGDFEMRETIWINLQNFKTVFKHTPLWLRFKDNVHIQKVKNCLLANDEISVEDQQMVEF
FQHFNNGNDADSKTMNEENYGTLISIQHLQSIVNRQIVNWLDNTEFNLMGQEETSSTYEE
QSGLVFDLLDTLSLNDATKFPLIFILKYLEAIKENSYQTALDSLHNYFDYKSTGNSQNYF
HISLLSLATFHSSFNECDAAINSFEEATXIARENKDMETLNLIMIWIINFIEVHPEYANR
FYITVEQIIKYLKNSSDVEDANIFSNAYKFETLLSMVKESKTAEVSSSLLKFMAITLQNV
PSQNFDLFQILVSYEVKFWKELGYESISDVYEKFLSKTSSSSLRNYDSSIINQDIKVAFK
ALEEDDFLKVKQYLLKSESLKLDYDQKINLKYLRVKYLVKIGDYDLSMRLINQYVKECCE
EVADSNXRFKFEIESINVLLLSDVGIRSLPKIIKLIDXYKEIGNPLRCVILLLKLCEVLI
QVGKSMEAEXLISCNLSTILEFPFVRKKTDELLESLSVEEDRDVQMT
Download sequence
Identical sequences YOR249C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]