SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR299W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR299W
Domain Number 1 Region: 173-218,391-436
Classification Level Classification E-value
Superfamily TPR-like 0.00000612
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOR299W
Sequence length 442
Comment BUD7 ORF Verified Member of the ChAPs family of proteins (Chs5p-Arf1p-binding proteins: Bch1p, Bch2p, Bud7p, Chs6p), that forms the exomer complex with Chs5p to mediate export of specific cargo proteins, including Chs3p, from the Golgi to the plasma membrane
Sequence
MCADYDXIWAETFVSGVVRSIMLMKENAEEGELQNLVETLILNPFTAGQIDDVPEMFIDL
FPIVYHKGPLLGAPYYITNVTNTNNYLVETLVEIVKLTRNVSRAEIMLKNLATDNPEAII
ILIKIFLVCDQELDAIKLTYDMLSQDKIINNTNNRMDYKSELLCLQAQFLIDKRQDYSLA
QNIAQEAVNCSPSEFRPWYLLSKVYVKLNDIENALLILNSCPMSPLKEKYVLKRVAPLPS
NNSLHLPLPIDVVLDEVTSLNPQDVQNEHRSADPMLVNLAASNLKSTFQLAYRLLTEIVQ
ITGWENLLKYRSNIFVMEEEYQKSSSSXPKDVNKQEEQPLRAKRLCERWLDNLFMLLYED
LKMYTLWQTEQLYMDAQNNNHNKLTFEWELFGLCARRLGHFPEAAKAFQNGLSQRFSSRC
ARKLLEYCINERQRVKKFYKLT
Download sequence
Identical sequences YOR299W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]