SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR155W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR155W
Domain Number 1 Region: 81-211
Classification Level Classification E-value
Superfamily TPR-like 5.06e-24
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBR155W
Sequence length 385
Comment CNS1 ORF Verified TPR-containing co-chaperone; binds both Hsp82p (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase activity of SSA1, ts mutants reduce Hsp82p function while over expression suppresses the phenotypes of an HSP82 ts allele and a cpr7 deletion
Sequence
MSSVNANGGYTKPQKYVPGPGDPELPPQLSEFKDKTSDEILKEMNRMPFFMTKLDETDGA
GGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVEXEDKSIN
ESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATF
ANQRIDQENKSILNMLSVIDRKEQELKAKEEKQQREAQERENKKIMLESAMTLRNITNIK
THSPVELLNEGKIRLEDPMDFESQLIYPALIMYPTQDEFDFVGEVSELTTVQELVDLVLE
GPQERFKKEGKENFTPKKVLVFMETKAGGLIKAGKKLTFHDILKKESPDVPLFDNALKIY
IVPKVESEGWISKWDKQKALERRSV
Download sequence
Identical sequences E7KKG1
YBR155W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]