SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR214W from Saccharomyces cerevisiae LalvinQA23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR214W
Domain Number 1 Region: 22-131
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-32
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 168-235
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 6.8e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.00044
Further Details:      
 
Domain Number 3 Region: 285-371
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000536
Family HSP40/DnaJ peptide-binding domain 0.0031
Further Details:      
 
Domain Number 4 Region: 135-160,225-279
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000222
Family HSP40/DnaJ peptide-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YMR214W
Sequence length 377
Comment SCJ1 ORF Verified One of several homologs of bacterial chaperone DnaJ, located in the ER lumen where it cooperates with Kar2p to mediate maturation of proteins
Sequence
MIPKLYIHLILSLLLLPLILAQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEE
AHQKFIEVGEAYDVLSDPEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMF
QGGHGGPGGGFGQRQRQRGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSGSADG
KLAQCPDCQGRGVIIQVLRMGIMTQQIQQMCGRCGGTGQIIKNECKTCHGKKVTKKNKFF
HVDVPPGAPRNYMDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSA
AEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKGYGDLYIDYVV
VMPKTFKSGQNMLKDEL
Download sequence
Identical sequences A0A0L8VJC6 A0A250WEL3 A6ZMS6 B3LMA2 B5VPY1 C7GRD7 C8ZF78 E7KSY1 E7QIJ9 G2WKS1 P25303
YMR214W SCRT_02108 YMR214W tr|A6ZMS6|A6ZMS6_YEAS7 YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W 4932.YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W NP_013941.2.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]