SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL105C from Saccharomyces cerevisiae M22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL105C
Domain Number 1 Region: 465-580
Classification Level Classification E-value
Superfamily PH domain-like 9.25e-17
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 
Domain Number 2 Region: 261-440
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000356
Family FCH domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YIL105C
Sequence length 686
Comment SLM1 ORF Verified Phosphoinositide PI4,5P(2) binding protein, forms a complex with Slm2p; acts downstream of Mss4p in a pathway regulating actin cytoskeleton organization in response to stress; phosphorylated by the TORC2 complex
Sequence
MSKNNTMTSAVSDMLSQQQLNLQHLHNLQQHTRSMTSADHANVLQQQQQQQQQQQQQQQQ
QQQSASFQNGSLTSDINQQSYLNGQPVPSTSNSTFQNNRTLTMNSGGLQGIISNGSPNID
SNTNVTIAVPDPNNNNGKQLQGKNSLTNTSILSRARSSLQRQRLAQQQQQQQDPRSPLVI
LVPTAAQPTDILAARFSAWRNVIKSVIVYLTEIASIQDEIVRQQLRLSHAVQFPFFSIEN
QYQPSSQEDKSVQKFFLPLGNGSIQDLPTILNQYHESLASSASKASRELTNDVIPRLEDL
RRDLIVKIKEIKSLQSDFKNSCSKELQQTKQAMKQFQESLKDARYSVPKQDPFLTKLALD
RQIKKQLQEENFLHEAFDNLETSGAELEKIVVMEIQNSLTIYARLLGQEAQLVFDILISK
LDSGFFNVDPQFEWDNFISRDPNFLLPNLPMRTFKEIVYKYQFDPLTYEIKSGFLERRSK
FLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSPNSTGSD
AKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTSTSNIQDKYKFITQKLNLNS
DGKPKLTNNHTSINKYQLSNANSTMVENDENDDINSNYVGSTVTPKLDNQTNTNTSMSSL
PDTNDSELQDQVPNIYIQTPINDFKS
Download sequence
Identical sequences B3LTV2 B5VKK5 P40485
YIL105C YIL105C YIL105C YIL105C NP_012161.1.97178 YIL105C 4932.YIL105C YIL105C YIL105C YIL105C YIL105C YIL105C SCRT_05278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]