SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR174C from Saccharomyces cerevisiae M22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR174C
Domain Number 1 Region: 2-30
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 6.8e-16
Family Proteinase A inhibitor IA3 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YMR174C
Sequence length 68
Comment PAI3 ORF Verified Cytoplasmic proteinase A (Pep4p) inhibitor, dependent on Pbs2p and Hog1p protein kinases for osmotic induction; intrinsically unstructured, N-terminal half becomes ordered in the active site of proteinase A upon contact
Sequence
MNTDQQKVSEIFQSSKEKLQGDAKVVSDAFKKMASQDKDGKTTDADESEKHNYQEQYNKL
KGAGHKKE
Download sequence
Identical sequences A0A0L8VJG7 A6ZMN3 B3LM60 C7GTS7 C8ZF36 N1P0F8 P01094
YMR174C YMR174C YMR174C YMR174C YMR174C YMR174C 4932.YMR174C YMR174C YMR174C YMR174C YMR174C YMR174C YMR174C YMR174C YMR174C YMR174C YMR174C SCRT_02065 YMR174C YMR174C NP_013899.1.97178 YMR174C YMR174C YMR174C YMR174C tr|A6ZMN3|A6ZMN3_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]