SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.004918.t1|scaffold263.1|size248082|19 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  symbB.v1.2.004918.t1|scaffold263.1|size248082|19
Domain Number 1 Region: 262-309
Classification Level Classification E-value
Superfamily RING/U-box 1.15e-19
Family RING finger domain, C3HC4 0.0037
Further Details:      
 
Domain Number 2 Region: 101-176
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0000000000000265
Family Cdc48 domain 2-like 0.0013
Further Details:      
 
Weak hits

Sequence:  symbB.v1.2.004918.t1|scaffold263.1|size248082|19
Domain Number - Region: 18-97
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.00523
Family Cdc48 domain 2-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.004918.t1|scaffold263.1|size248082|19
Sequence length 314
Sequence
MNTDYFIEGSPLKRFEKVQFICLWDFERARTDQDATTLFRDYINPYFKEKNSQEVTSILS
LHERLPIQNMEFEVMAAEPVPPEIGIVDLNTVVFVDWDSTPEFTKIHFVPFQDTLPAAYE
YDIFNDYLKPYLTRNKLQNFNQNDHFTFQGVQFKVVCCEPRGPARISKNTTIFCEGVLHP
SLRNLLPPEMIEQLQTLPPGLQMMLLNTEAIAGGYEERLIEVQDILSRRHGMQQEHIERI
PAQRWNPETDHDGHNDHNGQTTCMVCLNAFEANNEVRQLPCGHVFHVSCIDEWLRRCTDC
PICKTNVDRAVRQY
Download sequence
Identical sequences symbB.v1.2.004918.t1|scaffold263.1|size248082|19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]