SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.009545.t1|scaffold604.1|size182248|3 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  symbB.v1.2.009545.t1|scaffold604.1|size182248|3
Domain Number 1 Region: 33-292,325-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.47e-65
Family Motor proteins 0.0000251
Further Details:      
 
Domain Number 2 Region: 461-556
Classification Level Classification E-value
Superfamily SET domain 0.00000000327
Family RuBisCo LSMT catalytic domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.009545.t1|scaffold604.1|size182248|3
Sequence length 571
Sequence
YLMQMRAMTRSSVRFKMNFKLRWRARLVLRGAVCILAYGATGSGKTHTVTNIAERVAQRL
NSEAELLEKEGCHLEVLVQIVEIYNEHFRDLLTVADVSHNAHNATPRLKMFSPSSGATLQ
GVTHRRITRGKDMLKGLQSALRFGQAQRATCSTSVHGRSSRSHLVMMLYLLTCDESGSQR
QLGRLSLVDLAGSERIKCSEATGDRLREAQHINRSLSALADVVVAKEKGVPHVPYRNSKL
THLLQDALGGQHNSRTTIIIALPPTRAALGETLHSLQLSSRLNSIAAQRMYLPSGHLLSE
RGFEEDDSLLFARHEAERLRLENVLLRNRIQQLEERDEAREQELKELREQMHIALDLQVQ
PKQVENCWRSTSPPSPADSSAEHSRISECQVEKASPIPADELQAEAPSDQPEMEAAARAL
DFSSHFSDGILGSSPQIKGGHVPDQSALLEQTEQDEKSGLENGAFVHDGIDLFAPSERGE
RGIVARKPLSAGEVVLRIPGHLSLQSRCAAMPDSEISNFWRRHAEGHSVSNALRLTLTLM
HEQHVQKSRSRWWPYLMLGRRTTWLFINARN
Download sequence
Identical sequences symbB.v1.2.009545.t1|scaffold604.1|size182248|3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]