SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.025452.t2|scaffold2469.1|size78468|8 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  symbB.v1.2.025452.t2|scaffold2469.1|size78468|8
Domain Number 1 Region: 1064-1234
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.45e-34
Family CRAL/TRIO domain 0.00088
Further Details:      
 
Domain Number 2 Region: 374-450,528-587
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000278
Family Calbindin D9K 0.088
Further Details:      
 
Domain Number 3 Region: 987-1059
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000798
Family CRAL/TRIO N-terminal domain 0.0031
Further Details:      
 
Domain Number 4 Region: 1374-1457
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000196
Family CRAL/TRIO domain 0.018
Further Details:      
 
Domain Number 5 Region: 1293-1352
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000209
Family CRAL/TRIO N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.025452.t2|scaffold2469.1|size78468|8
Sequence length 1502
Sequence
MKKRVAAEPMNHVIAVSCLSSLFSKRIRSFRIGRPLGIHGNVRTRTQARKKLSKSVMTRP
ARYTYVGEIVAYEPDGPRNPEPEEDLRNCLRDALFRSSKPISLTSLFWRPYYYATCQVSL
PRRGWDFADTAVDDEIPTNFDAQPWNGDMMCTHCASHCGSHSSKRSYVFNHPLELHLDQK
EVDTTTTDLADPIPPRLVFQVLRVDGWERQFLEGYTFIDLPREPGSYNLNGSLWAPRGNL
SERLSASFCGAFVPLAAPDLVASDEYQLPRNRSGLCVRSAGCLQIRLQVLRHAPERPPSR
ESRSARLKRLELRRRDGRSGSLEGLRRRNLRRNKVSESRTRLHKEAKKRTAILRSAEFGA
CRVSSMLSMWQGALQIFQHCDRERKGYLTWEHGEVYVFISKVFEQQGLVPPSQEQIRSLF
QAFDSNRNGCLEPKEGLCLVDALARAIILAQSPQGYPKSPPKASSYSLAEEWLTSFQPPA
MAVEVNYGGTEPVNLQLLAAHIKPVLSQNSRHRSRMVAAIESGELLKESMRLFKQCDADR
NGKLTWNEGEIRRFISQVLQHYNLVEQLYEIYRHFDRDRSYSLDVRESLCLVDAVVRAMY
VSPTHSVGSRPSREVGSPPIRRAAMTDEELARRVAHQDAAMEKKIERLIRACSDSVALRV
STGVMHVMFSAWRQCATKDLFARAKQGWDRQCEELSAAAEKAKRRLEEEQRGFEDELERM
EQRRVLDTTASLSAREAAEVAAEAEEEAIRKHLKERQLWEARMKEERQQRERLEREFRDS
LQLAEAQAEERAEARFVQERQLYEERLKEERDRRVRAETAKAQALDHWAEEARKLKKNAV
QQVMANWLPKNSKEQVARQLRGIAGKWLELAKAGGRRRGRLTALDKAVMSWGRKALSGRP
GPSFHAWRDVIRAQRRAKAAVGVLSRQWLGGSKGLMASYMAEWRQLLAEKRQNELKAKRK
ARAHAQISLLVAQWERGQKAGSLRALRCGGLKDVQKVAVEGLAERLQKREGAEGEGLYDD
TLALVRYLRARNWDLDLAEALIRKTGTWRTDFGFSKIFTSESEEDIAQEASFGNIYVRGY
DKLGRPALYFKPGRDGFNAEPSGVKYLVYCLERAIACVDKKAKLGQLMVSPEDDPVARKF
VLLVDFEGVGLGSLVPLTIVRDLMVVMQDHYPERLGLAFFVNTPWLLHSFFTAASTFLDP
VTLAKFNFVSEDTSQTMEQHFDLRFLEKSFGGCDEEPFCSHIFLNTHSGEGVFGLEYAEQ
LHLSPQDLSLPDHSFEYVDFLHVYRHWRVLRLPSQKRLWLRQLAKQLSSRAEDGMDYFIE
PSTLLRYLRVHDWDVDKAATAVCATARWRKEHIHVLGDVRSGRCSAAIGRECALGRFYLR
GFDLRGRPIVYLKFHHEDSGHYQETINYVIYVMERLVALLRRMEDSQQEKEPNDVVADAD
CATVLVDFNGYSSSHRPGQQDQAMHSRPQMPILLSHQTALNGKQATSADIVDSPAHHPGP
LS
Download sequence
Identical sequences symbB.v1.2.025452.t2|scaffold2469.1|size78468|8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]