SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for symbB.v1.2.027753.t1|scaffold2735.1|size73862|1 from Symbiodinium minutum clade B1 v1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  symbB.v1.2.027753.t1|scaffold2735.1|size73862|1
Domain Number 1 Region: 67-178
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000484
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0028
Further Details:      
 
Domain Number 2 Region: 1302-1629
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000000205
Family Reverse transcriptase 0.026
Further Details:      
 
Weak hits

Sequence:  symbB.v1.2.027753.t1|scaffold2735.1|size73862|1
Domain Number - Region: 6-56
Classification Level Classification E-value
Superfamily SRCR-like 0.000419
Family Scavenger receptor cysteine-rich (SRCR) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) symbB.v1.2.027753.t1|scaffold2735.1|size73862|1
Sequence length 2555
Sequence
LVAVPGGAAHAGLLEMEMEAGGYGTVCGLNSQAANVACRQIGFEFGVVSPAQASAAQAVS
CQAFAGVGVRLVAVPGGAAHAGLLEMEMEAGGYGTVCGLNSQAANVACRQIGFEFGVVSP
AGCAEYGGASFCGASGSPVAAKALQCAGTEMSLKECKHNAPDDACLSHASDSVVFCGTST
TGAFFDGELRLIGASGAPVLPHEVGRLEMYLAHTQAWAPVCREGFTRSESSVTQCRAGRI
SGTVLRRGWGPDWETCVGMKIAPFAPTFGKSFTGSLGFMYYVLGSKSAKLCVESKRIIGC
ASRMYLQKRKLKQKSPLLVKQVIGLEKICNNEVDATLEEKVASGFFLFMVFARARHSDAQ
SAGCILLDLVEGEDGVDGFVEASIGRSKTSYSLERKTRFLPMSAQIRGLQQHDSWAINWF
KHMDKANLPRGKDLPLLPAPLRDGTWGKLPLSAEASGAWLRHLLLKVGTQKSDLLQYGTH
SLKTTTLSWLAKRGVARETRAALGYHAKAVDGTEVVYGRDNMAAPLRVLSSVVAEIFDGA
FRPDATKSGMLSKNARPTSDLVNGPLFKPSGFSEVVNVEKPLDSDPPEGDATGGDQSDIS
SEDSNDESEPDHDAIEDAIASVVGRWCPVSEVFDESSVVYVRHSLSRMIHIAADEYSEKF
MCGRELSSVYFKLTRKPEARLKAVGFNDDIKDKFFNAGITCLSQLAFMSSFTPGSSDETP
LIDAFKDLLGRDPTIGEKANMRRVFSEAYATVTTEMRQTVERVEETSVRKLSQPERHDRY
VKQVGRLTGVSIKGPTEPGDSLVDAFCSMYDDNRLRFIDWEKYVSKDQELQSDSKKITSF
ALDQSTGKLKVESKGPEEKADTSSDIMVLQALTRRSLAMDQANLVTFTKMQAWVDRLVKC
RTEEPPPGYSTPSLRQIMLADQKLFIELADRTRSGIQATVTGKPIDDIIETVMFMNEVTC
LLQPLPKLKETSALRDGAGEPYIPKGKGAGGKGKGKKGGKTSRMPSDLVGCRSHTNSGSP
ICYGFNLKTCSEEVKNGRCSKGFHICAVLKCLAQHLTSSPLQIIKSRLTTLLAWKKKSVE
LQQDDEALFDGLSSGCRSVLKGKRISLMKFIAEEMGWPDKTLFDEMSSGFRLTGIQGKSG
VFEDDCKPPLHSEDELMTKGKFLRPALWGKIQSEPLQEFSKPLWDITMVEATEKQWLKGP
LSFEDINFLYEGDWLPVRRFAVFQKDKWRPIDDFSENGVNGSFGSMERVDLRALDETVWI
SVALMRSMKAGQFSFKLSDGNFLEGRVHESWYTGGTMPRPLVKTVDLKAAYKQLALNERD
ASKSVICLKNPHDGQVYGFACKTLPFGAVASVLHFNRFARFLRAVFLRCGVIACNYFDDY
PIVELSTLGDNTDGTLRAITKLLGVTVAEDKDASFSDKTDLLGVTLDLSDDIMGEVRVCN
KPDRKKDLSQALDNIISSGKINPLEIPTLFGRLQFAESQILGRAGGLAMKTLRKLEALRC
KSVDISDEQKLMFGFLKSRLNHSRPRSISTKPYSPPVLVFTDGAYEPSGDSEDTVGVASI
GGVIYYRENSSVKCRAFGCILPDDLVKSWASKGKKHLIGETELYAVVLARRIWASYLDNQ
RSIFFIDHGGVMSSCIKGLVVWCGDHKQTPGRLRKSDEARAFRRKLMRRPIALRGDTKFI
PPHMLGAIVHPYVQDVPGPQVARLRQFLHESTRQPLELSTGSVAVLQELCQGTIGRSWDA
VITPCCCAALAVLWLVLAPEKFPLQADTFSCAAGTAGKQKCTDIGEVDWIKSKFLVAKEG
DLAVLHNRNKMVNAFASTEWFAGTGGAVISRSVTSCAGMTAYLVLLAQTRVGFLSGGRGK
SFHHLTPQEQAAQKASLWAHWDMRGLVGAATIMGCLKYGACFSGLDDQDDPVLLFRMKDE
DLLEAPDDSAFLQSLRFSCARVNGVYPPLALVEAFITEEDSAPRVRRLHLMVVDLNRRRR
LPARAKRQLSKIQVDRCAAECWNTLPIPWKQNQEAYQLRYVFGYAMDGSDLPCYILWPIR
TAEQSFWCMDAWKGDWVQLDKCGFIAPVGIEHFFDAFCFNPQRPWRAAACQALGIPSCHV
AEDTHLEHLNENKFTLTPRHLPVERKATADMSRDDLDMVAGEESGSEAESGWAVTSEDAP
GLSKQIDRLLEGYCFQILATNRDPEAHNEKVIQTATHLTWILAEYLAVTIAWLTRSILDH
ASKILFDNDTQPLLTPSFWILPLYRELLNSARRIRPSAASERARGCTGLVKLICKENKEQ
RVKRKFHAGTPHPNDRGGFTQWQLGADGCREAVWLVVPSKGVILSTAWRAFFVMCFRRSV
QLHGRALVGKGLLTVAIMLPGRQDADDWLNFMLSQKNLWPTFTTRGTLTEEVSEQVFRKE
RRRLQAKHLWMEVKLRWRVLADRMYTKAPTGKSKEELDALLFDRAARRSHTNPYEEKAYR
GPAIKEVQAWWVQCKEWMSHFKGQSAPLVFDFKSLLKALSGKEAEAHSDVDAFMEHCAKR
WQTREGTYQLKRRRLKPDVRDPPEDRSADVDMADI
Download sequence
Identical sequences symbB.v1.2.027753.t1|scaffold2735.1|size73862|1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]