SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR367W from Saccharomyces cerevisiae PW5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR367W
Domain Number 1 Region: 17-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.34e-34
Family Calponin-homology domain, CH-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOR367W
Sequence length 200
Comment SCP1 ORF Verified Component of yeast cortical actin cytoskeleton, binds and cross links actin filaments; originally identified by its homology to calponin (contains a calponin-like repeat) but the Scp1p domain structure is more similar to transgelin
Sequence
MSYDKKADVTSLDEDLRQLRESKFSPEAIQNIKIWVYKSVLKEIAPPGDLLECLKDGTVL
CKLANILYEADTGEANHISWKSSKMPFVQMDQISQFLSFSRKYGVPEDELFQTIDLFEKK
DPAIVFQTLKSLSRYANKKHPDRFPVLGPQLSTKKPRPPVKSKPKHLQDGTGWSTFEYGY
MKGASQATEGVVLGQRRDIV
Download sequence
Identical sequences A0A0L8VGS6 A0A250WAA5 A6ZPJ5 B3LK22 C7GNQ3 E7M0V0 E7QL53 G2WNM6
YOR367W YOR367W tr|A6ZPJ5|A6ZPJ5_YEAS7 YOR367W YOR367W YOR367W YOR367W YOR367W YOR367W YOR367W YOR367W YOR367W YOR367W SCRT_01740 YOR367W YOR367W YOR367W YOR367W YOR367W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]