SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR200W from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR200W
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Prefoldin 1.27e-27
Family Prefoldin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR200W
Sequence length 114
Comment YKE2 ORF Verified Subunit of the heterohexameric Gim/prefoldin protein complex involved in the folding of alpha-tubulin, beta-tubulin, and actin
Sequence
MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE
QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKVRSELIKLNNTAASTGPGR
Download sequence
Identical sequences A0A0L8VLT6 A0A250WL81 A7A189 B3RH90 E7QI40 G2WJ31 H0GKD2
YLR200W YLR200W YLR200W YLR200W YLR200W YLR200W YLR200W YLR200W SCRT_04159 YLR200W YLR200W YLR200W YLR200W tr|A7A189|A7A189_YEAS7 YLR200W YLR200W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]