SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR457C from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLR457C
Domain Number - Region: 136-216
Classification Level Classification E-value
Superfamily Prefoldin 0.0115
Family Prefoldin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YLR457C
Sequence length 319
Comment NBP1 ORF Verified Spindle pole body (SPB) component, required for the insertion of the duplication plaque into the nuclear membrane during SPB duplication; essential for bipolar spindle formation; component of the Mps2p-Bbp1p complex
Sequence
MLKSVQGLWKDFFGIRDDGRKREYGSLDEVRKRSALRSRRKQMRPTGKSVLKRPRKVTDR
KTEEKIRSNRRKTPKRRLTKIFQTIRDVFSNDNENMSKMQNVCGDMTRILKKRSQGRPSY
MDTDTAKSRILRSDAFKRKISELKYNKQRISELRSGSSDGSSGKDRNQSLYLDREILLQR
QIKKRDEKIKALESKLQSLQEALNYSNEKYRILEDLLDSSNIDPSYTKSRRTMSNLAREN
DEIKPLKIDLSPSPIRRTNSLFTSSPMKTYNRDGNIPEMQPLQENISPACPTPPYRSRET
EKEDETLSPISVDFSSYLS
Download sequence
Identical sequences A0A250WK93 A7A1X8 B3RHW5 C7GUD4 E7KFQ6 G2WJR8 H0GKX2
YLR457C tr|A7A1X8|A7A1X8_YEAS7 SCRT_04395 YLR457C YLR457C YLR457C YLR457C YLR457C YLR457C YLR457C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]