SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR011C from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR011C
Domain Number 1 Region: 3-283
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.76e-111
Family Inorganic pyrophosphatase 0.000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YBR011C
Sequence length 287
Comment IPP1 ORF Verified Cytoplasmic inorganic pyrophosphatase (PPase), homodimer that catalyzes the rapid exchange of oxygens from Pi with water, highly expressed and essential for viability, active-site residues show identity to those from E. coli PPase
Sequence
MTYTTRQIGAKNTLEYKVYIEKDGKPVSAFHDIPLYADKENNIFNMVVEIPRWTNAKLEI
TKEETLNPIIQDTKKGKLRFVRNCFPHHGYIHNYGAFPQTWEDPNVSHPETKAVGDNDPI
DVLEIGETIAYTGQVKQVKALGIMALLDEGETDWKVIAIDINDPLAPKLNDIEDVEKYFP
GLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALDIIKETHDSWKQLIAGKSSDSKG
IDLTNVTLPDTPTYSKAASDAIPPASPKADAPIDKSIDKWFFISGSV
Download sequence
Identical sequences A0A0L8VVW9 A0A250WFW1 A6ZKV8 B3LNC9 B5VDY3 C7GM39 C8Z406 E7K9P9 E7KK57 E7LR48 E7NER2 E7QBD0 G2W919 H0GC88 N1P7Y2 P00817
SCRT_02953 YBR011C YBR011C YBR011C 4932.YBR011C YBR011C YBR011C YBR011C NP_009565.1.97178 YBR011C YBR011C YBR011C YBR011C YBR011C YBR011C YBR011C YBR011c___KOG1626 YBR011C 1m38_A 1m38_B YBR011C YBR011C YBR011C tr|A6ZKV8|A6ZKV8_YEAS7 cath|current|1m38A00/1-282 cath|current|1m38B00/1-282 1m38A YBR011C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]