SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL206C from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL206C
Domain Number 1 Region: 70-307
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-40
Family SSRP1-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YNL206C
Sequence length 455
Comment RTT106 ORF Verified Histone chaperone, involved in regulation of chromatin structure in both transcribed and silenced chromosomal regions; affects transcriptional elongation; has a role in regulation of Ty1 transposition
Sequence
MSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSGRHKKPRIDVSSD
LLKTDEISETNTIFKLEGVSVLSPLRKKLDLVFYLSNVDGSPVITLLKGNDRELSIYQLN
KNIKMASFLPVPEKPNLIYLFMTYTSCEDNKFSEPVVMTLNKENTLNQFKNLGLLDSNVT
DFEKCVEYIRKQAILTGFKISNPFVNSTLVDTDAEKINSFHLQCHRGTKEGTLYFLPDHI
IFGFKKPILLFDASDIESITYSSITRLTFNASLVTKDGEKYEFSMIDQTEYAKIDDYVKR
KQMKDKSMSEELKAKSKSKGQATDGTADQPSILQEATRQMQDEKKAGVFSDDDEENDQNF
EAESDLSDGSGQESSDGAEDGEEAEEDDEEDDEEEDKKGQSALNRDNSFASINGQPEQEL
QYKEFKEPLELEDIPIEIDNDDDEDDEDGSGVEYD
Download sequence
Identical sequences B3LP50 C8ZG26 N1NXQ6 P40161
YNL206C NP_014193.1.97178 4932.YNL206C YNL206C YNL206C SCRT_03333 YNL206C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]