SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL257C from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL257C
Domain Number 1 Region: 18-268,307-335
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000000596
Family BAR domain 0.05
Further Details:      
 
Domain Number 2 Region: 307-423
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000575
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YNL257C
Sequence length 1229
Comment SIP3 ORF Verified Protein that activates transcription through interaction with DNA-bound Snf1p, C-terminal region has a putative leucine zipper motif; potential Cdc28p substrate
Sequence
MSVHGRDPKKRQLRLISVAFKEASIDSPSFRASVNFFQTRVDALEDWIEKTVDFFDQKYK
VSFEDFRRAKETLLSQLLPPPALLSNGFVSNQSFTPRLIDSFNKDYYDFSMKLLQIVKGD
DSSHSTALLELMTTAIEPYRNVRKNFDFYQGKYDSMLASYQAIRISKTSLEPSSIKSDAL
QLFEVQKNYLKASLDLISAISAVKLSLDKFILESMKVLKSRSIFITKDSGRKIDLSPCIN
EYLDNYAIWVENSIEGSKVLDSDISNAKKQAYRYTLKRITPSSDTSDYNIRSIHSSKLLS
KDTQVPPKSPEKSGWLYMKTQVGKPTREIWVRRWCFLKNAVFGMFLLSPSKTYVEETDKF
GVFLTNVRYDPEEDRKFCFEVKIFGNKVTEAHDNMSKDITLVFQTSNYLDLKSWLIAFEA
TKKYVMSIQHDSLEYELAFKRFSPKFFEFASSTTTSIDQLITTFDKETESLYETLNCSIS
EYDILTLGEEKVFQFQMPTTPISTKMTQLAILSNFLTKGSWFPNAVLANIWGTTDWSEYT
ILPGKGKKPSSLLTIDGKRLPIRNSTIYPQYYSNELKVLDLQFKSLVFSPDQRLEKLPEE
LLLFKFEAFWCPNKKQKFSATCFCTKDYIYCYMNSMEFICLTKISLSEIVSVEADRSSKK
TLKLYDASGLQMKAIVLFSDYKLIASKLQYLLENKAIKNPNSNEEILVKFEQMEKESQEK
KQEELYKIEQENSFDRKATSVSKIIKSRVTFWEMSDDASTLLNRLKKLQTEYSITYNHEY
EISSKGLAHILFGDKSNAFPKCLFLARKDGEEHGKRFWYKNKDINGKSQLVRKIPFRLDM
TGNFLNTGKYHRDKESKMIFATQRIVKIVDNKYYEVDLDPFFVKVPFCHLLKLSIKFVIT
ESYDVDNHLEIKLNMTASSSSLHVLYKLEYIDSRTGKTIEKLSLAEIICQTWALKFAHSE
FLLIRRVLRYYLEKIGKHGKVIKAIKLCGILGVLSNKSEEPATEKNGNSKESESMQYDIR
YSCTILFLVFIKLMVYRVTNLTFVFFRILIGILLLCAEKFSRINRMMVVGLLASIMINIL
LSEKASVPYWSIKRAEKLFHDRLGSDKFTMQRAIYISDSDLLSSQLSVPSNNPIFEKFSE
DNFNKDYQYSETRKQLAMRRNELLIELRILQDMEKQLVHDDYEKFLLEEVNKCSMVSIEM
TDLWFNDTQLQNYCSICNEELEKLRPPIT
Download sequence
Identical sequences A0A0L8VI98 B3LPA0
SCRT_03386 YNL257C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]