SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YAL003W from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL003W
Domain Number 1 Region: 119-207
Classification Level Classification E-value
Superfamily eEF-1beta-like 5.49e-33
Family eEF-1beta-like 0.00000295
Further Details:      
 
Domain Number 2 Region: 9-58
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000237
Family Glutathione S-transferase (GST), C-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YAL003W
Sequence length 207
Comment EFB1 ORF Verified Translation elongation factor 1 beta; stimulates nucleotide exchange to regenerate EF-1 alpha-GTP for the next elongation cycle; part of the EF-1 complex, which facilitates binding of aminoacyl-tRNA to the ribosomal A site
Sequence
MASTDFSKIETLKQLNASLADKSYIEGTAVSQADVTVFKAFQSAYPEFSRWFNHIASKAD
EFDSFPAASAAAAEEEEDDDDVDLFGSDDEEADAEAEKLKAERIAAYNAKKAAKPAKPAA
KSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKV
SLDDLQQSIEEDEDHVQSTDIAAMQKL
Download sequence
Identical sequences A0A0L8VW62 A0A250WP60 A7A0G4 B3LUU2 C8Z3H5 G2W8M7
YAL003W YAL003W YAL003W YAL003W YAL003W YAL003W SCRT_05639 YAL003W YAL003W YAL003W YAL003W YAL003W YAL003W YAL003W YAL003W YAL003W YAL003W YAL003W tr|A7A0G4|A7A0G4_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]