SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR330W from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR330W
Domain Number 1 Region: 199-342
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.13e-36
Family UAS domain 0.00013
Further Details:      
 
Domain Number 2 Region: 389-493
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-17
Family UBX domain 0.02
Further Details:      
 
Domain Number 3 Region: 4-44
Classification Level Classification E-value
Superfamily UBA-like 0.00000122
Family TAP-C domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR330W
Sequence length 500
Comment UBX5 ORF Verified UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p
Sequence
MSEGKVDEFMAITGADDAAIATQFIEMADGNLNTAISLFFENGGAALLSSNNTPTPSNST
PMAPTSVDSDADAQLAERLQREAYQQQQPDQDYVRPPDEARHEVLTETSGFPISYGGIGG
RFEPLHRVNDMFDEGRPESIFNQRLDDTNTNTYINDNSSDSLDSEEENDDDEYEYVEEPV
IELDEDGNIKEYTKLVRKPKTISKEQKLALLFRPPFSIMSKLDLDAAKQKARAKQKWIMI
NIQDSGIFQCQALNRDLWSSRPVKTIIKENFVFLQYQYESRNAQPYLQFYHLNNKDDLPH
IAILDPITGERVKQWNRVVPIPEQFISEINEFLASFSLDPKVPNPTVNEPLPKVDPTTLT
EEQQMELAIKESLNNNSSKSNQEEVPSTGEEQKRVQEPDPFSTIEARVHPEPPNKPGITT
RIQIRTGDGSRLVRRFNALEDTVRTIYEVIKTEMDGFADSRFTLNDHQREDLIDKLNMTI
ADAGLKNSSLLLEKLDPEIE
Download sequence
Identical sequences A0A0L8VU82 A0A250W8G0 A6ZYT2 B3LFW7 B5VGL3 C7GWM7 E7KM01 E7QD87 G2WB69 H0GEF9 N1PAI0 Q06682
4932.YDR330W tr|A6ZYT2|A6ZYT2_YEAS7 YDR330W YDR330W YDR330W SCRT_00199 YDR330W YDR330W YDR330W YDR330W YDR330W YDR330W NP_010617.1.97178 YDR330W YDR330W YDR330W YDR330W YDR330W YDR330W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]