SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL065C from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL065C
Domain Number 1 Region: 12-154
Classification Level Classification E-value
Superfamily TPR-like 1.2e-38
Family Tetratricopeptide repeat (TPR) 0.00000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YIL065C
Sequence length 155
Comment FIS1 ORF Verified Protein involved in mitochondrial membrane fission and peroxisome abundance; required for localization of Dnm1p and Mdv1p during mitochondrial division; mediates ethanol-induced apoptosis and ethanol-induced mitochondrial fragmentation
Sequence
MTKVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERL
GVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMV
EDKIQKETLKGVVVAGGVLAGAVAVASFFLRNKRR
Download sequence
Identical sequences A0A0L8VPE4 A0A250WM42 A6ZVK8 B3LTR8 C7GVY9 C8ZAI3 E7KPV2 E7LVT5 E7NJ09 E7Q557 E7QG40 G2WG83 H0GHX2 P40515
YIL065C YIL065C YIL065C YIL065C YIL065C YIL065C YIL065C YIL065C YIL065C YIL065C YIL065C SCRT_05242 YIL065C YIL065C YIL065C YIL065C YIL065C 4932.YIL065C tr|A6ZVK8|A6ZVK8_YEAS7 YIL065C YIL065C NP_012199.3.97178 YIL065C YIL065C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]