SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKL026C from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL026C
Domain Number 1 Region: 3-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.18e-52
Family Glutathione peroxidase-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YKL026C
Sequence length 167
Comment GPX1 ORF Verified Phospholipid hydroperoxide glutathione peroxidase induced by glucose starvation that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress
Sequence
MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIV
AFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGI
KMIKWNLEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI
Download sequence
Identical sequences C7GRI6
YKL026C YKL026C YKL026C YKL026C YKL026C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]