SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML013W from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YML013W
Domain Number - Region: 402-466
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000196
Family Ubiquitin-related 0.062
Further Details:      
 
Domain Number - Region: 14-60
Classification Level Classification E-value
Superfamily UBA-like 0.0023
Family TAP-C domain-like 0.031
Further Details:      
 
Domain Number - Region: 219-353
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0152
Family Thioltransferase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YML013W
Sequence length 584
Comment UBX2 ORF Verified Protein involved in ER-associated protein degradation; proposed to coordinate the assembly of proteins involved in ERAD; contains a UBX (ubiquitin regulatory X) domain and a ubiquitin-associated (UBA) domain
Sequence
MPVVNHEDSEFHLSHTEEDKLNEFQVITNFPPEDLPDVVRLLRNHGWQLEPALSRYFDGE
WKGEPDQMGEPTQTSTPMAETLVPPALGPRPLLFTASLPVVRPLPANFRNDFRTIGLNGR
SNTVWSMFESFSYDGNPFLFILLLIPRIINRLSATIFTFFCTLLSLHSISGGGNSGKPKI
SKVPKAPTRETHIPLAEILGDTKDKDAFCELKSFKPDISFNEALRIAKEEFKFMLLILVG
DTYDTDTDTVDVNSKLLLEKILLNKKTLQYLRKIDNDLIIYLKCVHELEPWLVARQLGVR
NTPEIFLIANVANKASHSETLPSQRLSILGKLKVNSLNRFLQSLTNVVEKYTPELVVNKT
EMHELRMSREIKKLQEDAYKKSLEMDRIKAIEKEKSLKHAQDLKLNSTARQLKWLKACID
EIQPFETTGKQATLQFRTSSGKRFVKKFPSMTTLYQIYQSIGCHIYLAVYSSDPAEWSNA
LQDKIRQLSADDDMLCFKEGQLETATATTIEELGHIINNELTSFDLERGKLEFDFELVSP
FPKYTVHPNEHMSVDQVPQLWPNGSLLVEALDEEDEEDEENEEQ
Download sequence
Identical sequences N1P5A1 Q04228
YML013W 4932.YML013W NP_013699.1.97178 YML013W YML013W YML013W YML013W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]