SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR018W from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR018W
Domain Number 1 Region: 202-506
Classification Level Classification E-value
Superfamily TPR-like 9.1e-71
Family Tetratricopeptide repeat (TPR) 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YMR018W
Sequence length 514
Comment ORF Uncharacterized Putative protein of unknown function with similarity to human PEX5Rp (peroxin protein 5 related protein); transcription increases during colony development similar to genes involved in peroxisome biogenesis; YMR018W is not an essential gene
Sequence
MNEVTCSITGDNPIHKINNGLGLKWNNLGKFSDFQTNDSAARDARTIDYIFTNCQTGSSI
GKIDFRAALPADKSQHSGVSEKEFSRLENQWSKEFSCFPKNKNADVTKPSRNKHEKRSAN
LHNRYFAQYYSTAYQQNRIYPCRISYNEHSSVSNGWEFQFKSIENQLLNELKIENNVEEK
TVGYEYVAEYEETIDFMHMLSSVPQTYQFLKSNIYITERDPYKIGCVLMDNGSNLNEVVM
AFEAAISQDPSHINAWLKLGIVNFENESESNGELALRNCLNLDPNNTIALENLAIHHINQ
QNESESLKLFHKWILSKFSKVFQPSAGENKDSINKIPKKAHLVHILESLLNMGIEKKDQY
DIYSVLSILYYSDQKIKQSQKCLEFLLLEKPNNGTIWNRYGAILANTKSYHSAINAYNKC
KQLRPNFTRVRYNLAIAYMNKGDYVKASKMLIEVILLRSKGYEHNKAKMQNKFMQNLKNA
LIASKNFDSLDLINGSHNTESLISTLKAIYNKMD
Download sequence
Identical sequences A0A0L8VJX9 A0A250WEP7 B3LLS0 B5VPE5 C8ZEM6 G2WK69
YMR018W YMR018W YMR018W YMR018W YMR018W YMR018W SCRT_01914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]