SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR251W from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR251W
Domain Number 1 Region: 190-347
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0082
Further Details:      
 
Domain Number 2 Region: 29-82,147-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000104
Family Glutathione S-transferase (GST), N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YMR251W
Sequence length 366
Comment GTO3 ORF Verified Omega class glutathione transferase; putative cytosolic localization
Sequence
MSEKSASNNKAEFKRQSSPFREIISADHPIYKPAKGRYWLYVALPCPWAQRTLITRALKG
LAPIIGCSVAHWHLDDKGWRFLEEGDGKTNERHWFDIAGGISSVNLNTSTPVANIPNNAH
RLLVDGTDEPHYGYKRLSDFYFKTKPDYKGRFTVPVLWDLETCTIVNNESSDIIGIMNSA
AFDEFVGEEYRQVRLVPRSLEAQITEFNSWVYDKINNGVYKAGFAECAEVYEREVTSLFQ
YLDKLENLLDKKYTDLEAEYGKNNKDKILDRYFAIGDTLTEADVRLYPTIVRFDVVYHQH
FKCNLATIRDDYSRIHTWLKNIYWRHEAFQRTTDFTHIKLGYTRSQPRVNPIGITPLGPK
PDIRPP
Download sequence
Identical sequences Q04806
YMR251W YMR251W 4932.YMR251W NP_013977.1.97178 XP_015331920.1.40921 YMR251W YMR251W 355060 YMR251W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]