SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR007C from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR007C
Domain Number 1 Region: 101-178
Classification Level Classification E-value
Superfamily TPR-like 3.37e-26
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOR007C
Sequence length 198
Comment SGT2 ORF Verified Glutamine-rich cytoplasmic protein that serves as a scaffold for binding Get4/5p and other proteins required to mediate posttranslational insertion of tail-anchored proteins into the ER membrane; has similarity to human cochaperone SGT
Sequence
MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF
KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL
AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLVLLN
MRKVNPKKPLKHTKRFLI
Download sequence
Identical sequences YOR007C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]