SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL097C from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL097C
Domain Number 1 Region: 328-409
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.42e-17
Family PCI domain (PINT motif) 0.034
Further Details:      
 
Domain Number 2 Region: 119-333
Classification Level Classification E-value
Superfamily TPR-like 0.00000533
Family SCOPe 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDL097C
Sequence length 434
Comment RPN6 ORF Verified Essential, non-ATPase regulatory subunit of the 26S proteasome lid required for the assembly and activity of the 26S proteasome; the human homolog (S9 protein) partially rescues Rpn6p depletion
Sequence
MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILE
LGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEK
SIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLL
ESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFF
ESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMK
AVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEIS
HISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLN
KVVDQLFEKASVLY
Download sequence
Identical sequences A0A0L8VSJ5 A6ZXN2 B3LGZ0 B5VFH2 C7GJL9 E7KAG6 E7LSE5 E7QCI1 G2WC67 Q12377
YDL097C YDL097C 354917 SCRT_00592 YDL097C NP_010186.1.97178 YDL097C YDL097C YDL097C 3jck_C 3jco_Q 3jcp_Q 4cr2_Q 4cr3_Q 4cr4_Q 5a5b_Q 5mpb_Q 5mpc_Q 5mpd_Q 5mpe_Q 5wvi_Q 5wvk_Q 6fvt_Q 6fvu_Q 6fvv_Q 6fvw_Q 6fvx_Q 6fvy_Q YDL097C YDL097C YDL097C YDL097C YDL097C YDL097C YDL097c___KOG1463 YDL097C tr|A6ZXN2|A6ZXN2_YEAS7 YDL097C YDL097C 4932.YDL097C YDL097C YDL097C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]