SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR035W from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR035W
Domain Number 1 Region: 83-333
Classification Level Classification E-value
Superfamily vWA-like 2e-32
Family Trunk domain of Sec23/24 0.001
Further Details:      
 
Domain Number 2 Region: 508-626
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.23e-20
Family C-terminal, gelsolin-like domain of Sec23/24 0.0035
Further Details:      
 
Domain Number 3 Region: 18-56
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.00000144
Family Zn-finger domain of Sec23/24 0.0058
Further Details:      
 
Weak hits

Sequence:  YHR035W
Domain Number - Region: 464-506
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.000165
Family Helical domain of Sec23/24 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YHR035W
Sequence length 630
Comment ORF Uncharacterized Putative protein of unknown function; not an essential gene
Sequence
MCSPTNFLYEPFSSDAVTQNYDQNLKCTKCGAYYSMACSLREQNVWTCLFCNQSNSNAEL
PLVPSNTYTLTSAKKEILSRRTIMIIDAICDPHELNYLVSILCNNYITRQQEPLSIITIQ
QSGHVILHNAVNHKRDAVFSINEFMTKYNLDKLNASYFEKKISEINQESYWFDKSTQGSL
RKLLREICKIANKANISSKRDKRCTGLALFVSSVLASQCSLSAYCHIVSFLNGPCTKGGG
KVMSRERGESIRQNHHFESKSSQLQLSKSSTKFYKKMLEKFANQTLIYEFFIASLDQIGI
LEMSPLITSSMAVSQFDSFNDERFAMSFQKYLNLRDHNAIYNCHSKIMTAKNAIVVKDFP
KYSLNPKNLSLPLEISLGHNSAEAPIQFQTTFENRTDKYIRIETLLLPKANGSFGAQNEI
VFSMKKIASRIIDSFAYSSKHTKELMKQLFLLPNQIRGKDVDMVNLIQWCYHIYRSPILS
VRNTSPDERYLFLHRIINASKDTCLSLCKPFIWSYSDLKHDWIVLDVPLTRAQILQDDKT
TICVDGGSYLVLRRGKLLEKEGRELCCKLLNDLQRFPQPLYVETKTGGSQDRFLKSKIIP
LDITDKETLGTEDMTFNEYFNLFTDLSGSK
Download sequence
Identical sequences A0A250WLV9
YHR035W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]