SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL005W from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL005W
Domain Number 1 Region: 30-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.39e-21
Family PDI-like 0.0038
Further Details:      
 
Domain Number 2 Region: 321-449
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000597
Family PDI-like 0.07
Further Details:      
 
Weak hits

Sequence:  YIL005W
Domain Number - Region: 161-252
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000132
Family Thioltransferase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YIL005W
Sequence length 701
Comment EPS1 ORF Verified ER protein with chaperone and co-chaperone activity, involved in retention of resident ER proteins; has a role in recognizing proteins targeted for ER-associated degradation (ERAD), member of the protein disulfide isomerase family
Sequence
MKMNLKRLVVTFFSCITFLLKFTIAAAEPPEGFPEPLNPTNFKEELSKGLHIIDFYSPYC
PHCKHLAPVWMETWEEFKEESKTLNITFSQVNCIESADLCGDENIEYFPEIRLYNPSGYI
KSFTETPRTKESLIAFARRESMDPNNLDTDLDSAKSESQYLEGFDFLELIAGKATRPHLV
SFWPTKDMKNSDDSLEFKNCDKCHEFQRTWKIISRQLAVDDINTGHVNCESNPTICEELG
FGDLVKITNHRADREPKVALVLPNKTSNNLFDYPNGYSAKSDGYVDFARRTFTNSKFPNI
TEGELEKKANRDIDFLQERGRVTNNDIHLVFSYDPETVVIEDFDILEYLIEPLSKIPNIY
LHQIDKNLINLSRNLFGRMYEKINYDASQTQKVFNKEYFTMNTVTQLPTFFMFKDGDPIS
YVFPGYSTTEMRNIDAIMDWVKKYSNPLVTEVDSSNLKKLISFQTKSYSDLAIQLISSTD
HKHIKGSNKLIKNLLLASWEYEHIRMENNFEEINERRARKADGIKKIKEKKAPANKIVDK
MREEIPHMDQKKLLLGYLDISKEKNFFRKYGITGEYKIGDVIIIDKSNNYYYNKDNFGNS
LTSNNPQLLREAFVSLNIPSKALYSSKLKGRLINSPFHNVLSFLDIIHGNGMPGYLIVIV
LFIAILKGPSIYRRYKVRKHYRAKRNAVGILGNMEKKKNQD
Download sequence
Identical sequences B3LTL4 C8ZAP4 P40557
YIL005W YIL005W YIL005W YIL005W SCRT_05185 4932.YIL005W YIL005W NP_012261.1.97178 YIL005W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]