SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJR088C from Saccharomyces cerevisiae Sigma1278b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR088C
Domain Number 1 Region: 87-123,152-257
Classification Level Classification E-value
Superfamily TPR-like 0.00000000835
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJR088C
Sequence length 292
Comment EMC2 ORF Verified Member of a transmembrane complex required for efficient folding of proteins in the ER; null mutant displays induction of the unfolded protein response
Sequence
MLKDLVREKLLTIMNTKAYTQFNPEQLLQLENEMKIYMKSGDSALTEGNYFFLMEMLFYV
LVYRNQDVDAQVVYNTLRDRLGENSYKMVIMKATLLQINGNDKGAIEYLENLLNDDLEYE
TDFVTYVSIAKKLIAIKTTSKNLSQESVLKEVVALTDKFPLDAELWWYASEIYFEMGQFE
KACYCLEQVLCITPFNYACFGRLSETLYYEALRSKKQTKTELLEKALKNALRSVELSELY
LKGWALVNIISRELGRNKQNDLIKLSASKLKEISAKSNNKDKITAELILNKI
Download sequence
Identical sequences P47133
355048 4932.YJR088C YJR088C YJR088C YJR088C YJR088C NP_012621.1.97178 YJR088C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]