SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim00g012660.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim00g012660.0.1
Domain Number 1 Region: 25-61
Classification Level Classification E-value
Superfamily F-box domain 0.0000017
Family F-box domain 0.0086
Further Details:      
 
Weak hits

Sequence:  Sopim00g012660.0.1
Domain Number - Region: 148-248
Classification Level Classification E-value
Superfamily GAF domain-like 0.0392
Family HrcA C-terminal domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim00g012660.0.1
Sequence length 405
Sequence
MGRRKPRVFFKNIPIDFPTERQSNMPIDLPIELQSNIFDRLCAKDQSKAMCVSHSWRDFI
LYSILPKDESQQSSVSLFPIKCLDLKLQQLFHWCSRVMCCRVGPNKLIDSCNGLLLFYHN
YGGAQNLTHGVYYYYVMNHVTKQCVAVSKPTGQISRAYSYATLVYDPTKSRFFQIVNFQG
HRHVNVFSSKNGIWTTQTLILPKYIIASSWTKKSVYFNGSLYRLSRSGHLVKIKVDIQEN
VLEQTEAITLPQDCLSFNCQWELSVKGDKLLFVMSKGLNFVVYELVECVSSGVTSCSWCT
SHRIQDDGSKWYYLNKLFKLLSFHPYDDVAFFKGYNHLFYYIFIGNNTITDLQQVPSCEI
LYDYLEFCGIPLVECYSPFACRLNEEHPRVFQRPPIPTVIRVISG
Download sequence
Identical sequences Solyc00g012660.1.1 Sopim00g012660.0.1 Solyc00g012660.1.1 XP_004253282.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]