SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim00g055960.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim00g055960.0.1
Domain Number 1 Region: 249-413
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.05e-40
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 2 Region: 179-260
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.16e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0007
Further Details:      
 
Domain Number 3 Region: 97-192
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000227
Family Heme-binding PAS domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim00g055960.0.1
Sequence length 428
Sequence
MLLLVTGCLVIGLITGYYGWSLAAGLGLYLAWTLKQLLRLHEWLRLHQPDEAPPDGYGLW
GEVFDSIYHLQRRDQRVRGRLQAVIDRVQESTAALKDAVIMLDSDGNLEWWNRAAETLLG
LKTPQDSGQPVTNLVRHPRFKEYFEQESYAEPLEIPSPTNDRVRIQLYLTRYGNNEHLML
VRDVTRIHQLEQMRKDFIANVSHELRTPLTVICGYLETLLDNVEEVNPRWSRALQQMQQQ
GGRMQTLLNDLLLLAKLEATDYPSDNQPVHIDTLLQSIKSDAQQLSGSKNQRITLEADTR
ILLKGSEAELRSAFSNLVFNAVKYTPAEGNIRIRWWGDDQGAHLSVQDSGIGIDSKHLPR
LTERFYRVDSSRNSNTGGTGLGLAIVKHVLLRHRARMEISSVPGHGSTFTCHFAPAQVAQ
ARVISAAE
Download sequence
Identical sequences Sopim00g055960.0.1 Solyc00g055960.1.1 Solyc00g055960.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]