SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim00g065930.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim00g065930.0.1
Domain Number 1 Region: 470-553
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.00000000000000207
Family PG0164-like 0.0005
Further Details:      
 
Domain Number 2 Region: 365-424
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000139
Family Viral proteases 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim00g065930.0.1
Sequence length 622
Sequence
MILGYPGRTNRYLTSYGIQQMVNKDYPAWVEASKLAMDIMKKYMDKDKGTQLNYASQYAS
VANYWKNRQGTIDAVIKNGTITDKQKVEERFKTWAVQPENIVQYETVLEDIGIYYKQTSE
RNVERMYMSQLSRNAKYFSLALQVGSVLKAYADQDMAGRLAMKPKVDAALKSAYENINTQ
LEGEMLNSMVNLYQTKVNKDVASETIMGLDAKNLSNVAYSSIFANKTSATNFVLNPDKLK
LDADPLWKIANGLVADQRASAERFVKIDDNFAKNNRLFLAGLMKAMPEKKFYPDANSTMR
LTYGTVDALPIRTDRNYFGVTENYYTDMAGLVGKYKKGDEEFDLPQRVIDLYNLKDFGQY
ADAKGYMPVNFLSNNDITGGNSGSPVIDGDGNLIGIAFDGNSEALSGDIVFEPEWQKTIN
VDVRFVLWTIDKYAGARRLIDELQLVRDENTPADTKTKMPKATPMKLQPIQFKAIIKQHG
TMNAAFVEFPFSAEELFNKKGQVKIKALFDDKVEYRGSLAKMKTAFHLLILTQEVRKQLE
KTFGDEISVSLTEDKEERTVEISDDILTVFNENPEAKTLFDKMSYTHKKEYIRWINEAKK
PETRENRKSKMIQMILEGKKGV
Download sequence
Identical sequences Sopim00g065930.0.1 Solyc00g065930.1.1 Solyc00g065930.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]