SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sopim00g125270.0.1 from Solanum pimpinellifolium A-1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sopim00g125270.0.1
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily GAF domain-like 1.37e-18
Family IclR ligand-binding domain-like 0.0087
Further Details:      
 
Domain Number 2 Region: 194-269
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000000000000458
Family DJ-1/PfpI 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sopim00g125270.0.1
Sequence length 274
Sequence
MADRDEMVYLESIRYGRKVSLRSVVAGQRVPMALTSLGRAWLAVAPEVEYAARMADFAAR
APHWPALRREIESAVAHVRRHGWCAASWQPEVVAISTPLALDHYPVHVLNVSLSTRAAAG
DVARELAPRLMRLASDIRDAVQTAQSEPCTRACCMKELAAALQARHQVGTDDALLASFRT
ISRTAIMGDKTLDGLNVAILVTDGFEQSELQEPRRALDEAGAHTRVVAPKDGEVKGWKLK
DWGDTVAVDVQLDAARAEDFDALLLPGGVINPXX
Download sequence
Identical sequences Solyc00g125270.1.1 Sopim00g125270.0.1 Solyc00g125270.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]